- Please log in to your account to complete this purchase.
Only left in stock
In stock
Tesamorelin (10mg)
$90.00
Tesamorelin is a peptide research compound for growth hormone pathway studies.
- ≥99% purity — third-party HPLC & MS tested
- Lyophilized & vacuum-sealed for maximum stability
- Cold-chain shipped • fast US & international delivery
Description
Tesamorelin Properties (PubChem)
Tesamorelin comes in the form of a Lyophilized powder. Each unit consists of one vial containing 10mg/vial.
- Molecular formula: C223H370N72O69S
Molecular weight: 5196 g/mol
Synonym: Tesamorelin acetate
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
CAS number: 901758-09-6

Tesamorelin is a peptide research compound for growth hormone pathway studies.
Research Use Only
DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.
Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.
Independent third-party lab testing — HPLC purity and bacterial endotoxin results are published for every batch.
Dispatched within 24 hours, via 2-Day Air, discreetly packaged.
Refunds and replacements are eligible for broken or incorrect items — email hello@minutemanpeptides.com within 48 hours of delivery with your order number.
Storage — keep cool and dry, away from direct sunlight. Refrigerate at 2–8 °C after reconstitution.
Supplied as lyophilized powder for laboratory research. Not for human or animal use.
Compound information
What is Tesamorelin?
- Type
- Synthetic peptide
- Class
- GHRH(1–44) analog
- Amino acids
- 44
- Molecular weight
- ~5,136 g/mol
- Form
- Lyophilized powder
Stability information
Research applications
- GHRH receptor research
- Adipose tissue metabolism studies
- Endocrine research models
Sources & references
For Research Use Only. Not for use in diagnostic procedures or human or veterinary applications. This product is sold exclusively as a laboratory reagent for qualified scientific investigation and is not intended to diagnose, treat, cure, or prevent any disease. Specifications are provided for reference only — see the certificate library for batch data.











